PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G172100.1.p
Common NameGLYMA_20G172100, LOC100787232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 550aa    MW: 61694.6 Da    PI: 4.5048
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G172100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.7e-54201462128
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                          +pGfrFhPtdeelv++yLk+k+ gk+l+l +vi+e+d+yk++P+dLp +  +k+++++w+fF++rd+ky++g r+nrat++gyWkatgkd
  Glyma.20G172100.1.p  20 MPGFRFHPTDEELVMYYLKRKICGKRLKL-DVIHETDVYKWDPEDLPgQsILKTGDRQWFFFCHRDRKYPNGGRSNRATRRGYWKATGKD 108
                          69***************************.9***************96446788999********************************* PP

                  NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++v++ +++ vg+kktLvfy grap+ge+tdWvmhey+l
  Glyma.20G172100.1.p 109 RNVIC-NSRSVGVKKTLVFYAGRAPSGERTDWVMHEYTL 146
                          *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6015169IPR003441NAC domain
PROSITE profilePS5100554.57919169IPR003441NAC domain
PfamPF023654.6E-2821146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MGEASGAGSA DCFSQMMSSM PGFRFHPTDE ELVMYYLKRK ICGKRLKLDV IHETDVYKWD  60
PEDLPGQSIL KTGDRQWFFF CHRDRKYPNG GRSNRATRRG YWKATGKDRN VICNSRSVGV  120
KKTLVFYAGR APSGERTDWV MHEYTLDEEE LKRCQGVKDY YALYKVYKKS GPGPKNGEQY  180
GAPFNEEEWA DDDIVDFNIN SADQEAPNDV ADNVNVPLPF LDDEINNIIR EILDDELVLD  240
QQHVNGYPDF PQVVSEETQS TVVDQFSEDV MLPEPVRISH PSCQFFDAQP SFDFNRPVTS  300
HLHVSETSEV TSASNIKTKE LDFNEDGFLE INDLIDTEPT LSNVENSVEY QHFEDGLSEL  360
DLFQDAQMFL RDLGPIIHET DSHAYTNALV SSNIECQSYQ LLPNPEDANQ TVGEFWMHGE  420
SNQLSSPGVV YESVGFPTEG NNNQSSTVED VATSSLSSAL WAFVESIPTT PASAAESALV  480
NRALNRMSSF SRLKIKHTNI AASGKDTGTM KRAGRKGLPF LFFSILIALC AFCWVFVGNL  540
RLVGRSISP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-502114617140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13746KRKICGKRLK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.287500.0cotyledon| hypocotyl| leaf| root| seed coat| somatic embryo| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6573050.0KF657305.1 Glycine max NAC transcription factor (SNAC38) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556180.10.0PREDICTED: NAC domain-containing protein 17
RefseqXP_006606193.10.0PREDICTED: NAC domain-containing protein 17
SwissprotQ9XIC51e-135NAC17_ARATH; NAC domain-containing protein 17
TrEMBLI1NH700.0I1NH70_SOYBN; Uncharacterized protein
STRINGGLYMA20G31210.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Representative plantOGRP9932711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-136NAC domain containing protein 17